PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054831.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 142aa    MW: 16007.5 Da    PI: 10.4654
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054831.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-3367120255
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   prlrWtp+LH++F++aveqLGG++kAtPk +l++m+vkgLt++hvkSHLQ+YR+
  EcC054831.10  67 PRLRWTPDLHQCFMHAVEQLGGEDKATPKMVLQMMSVKGLTISHVKSHLQMYRS 120
                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.59663123IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-3263122IPR009057Homeodomain-like
SuperFamilySSF466892.96E-1764121IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-2567121IPR006447Myb domain, plants
PfamPF002496.4E-968119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000462Biological Processmaturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0030515Molecular FunctionsnoRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MVHGEESSLK KSNSPSSSVV NVDGPSSESS NLRGDRKRGN EMLALLPLGT ISRRPSVVRP  60
YVRSKTPRLR WTPDLHQCFM HAVEQLGGED KATPKMVLQM MSVKGLTISH VKSHLQMYRS  120
MKHEQIMQGH LYNSTTFLCI FL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518461.28e-43PREDICTED: putative Myb family transcription factor At1g14600
RefseqXP_007026111.12e-43Homeodomain-like superfamily protein
TrEMBLA0A059CF664e-70A0A059CF66_EUCGR; Uncharacterized protein
STRINGVIT_00s1624g00010.t011e-46(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.14e-29G2-like family protein